YPT1, Recombinant, Saccharomyces Cerevisiae, aa1-206, His-SUMO-Tag (GTP-binding Protein YPT1)
Référence 375896-100ug
Conditionnement : 100ug
Marque : US Biological
375896 Rabbit Anti-YPT1, Recombinant, Saccharomyces Cerevisiae, aa1-206, His-SUMO-Tag (GTP-binding Protein YPT1)
Clone Type
PolyclonalSwiss Prot
P01123Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CThe small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins.||Source:|Recombinant protein corresponding to aa1-206 from saccharomyces cerevisiae YPT1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.||Molecular Weight: |~39.2kD||Amino Acid Sequence:|MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.