- Specifications
Product Description
Human TRUB2 full-length ORF ( NP_056494.1, 1 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
63.1
Interspecies Antigen Sequence
Mouse (81); Rat (79)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — TRUB2
Entrez GeneID
26995GeneBank Accession#
NM_015679.1Protein Accession#
NP_056494.1Gene Name
TRUB2
Gene Alias
CLONE24922, RP11-339B21.1
Gene Description
TruB pseudouridine (psi) synthase homolog 2 (E. coli)
Omim ID
610727Gene Ontology
HyperlinkGene Summary
Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 [PubMed 12736709]).[supplied by OMIM
Other Designations
OTTHUMP00000022257|TruB pseudouridine (psi) synthase homolog 2
- Interactomes
TRUB2 (Human) Recombinant Protein (P01)
Référence H00026995-P01
Conditionnement : 10ug
Marque : Abnova
Images