K99 Fimbrial Protein, Recombinant, E. coli, aa23-181 (fanC)
Référence 405969-100ug
Conditionnement : 100ug
Marque : US Biological
405969 Rabbit Anti-K99 Fimbrial Protein, Recombinant, E. coli, aa23-181 (fanC)
Clone Type
PolyclonalSwiss Prot
P18103Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CFimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. FanC is the main component of the K99 fimbriae.||Source:|Recombinant protein corresponding to aa23-181 from E. coli K99 fimbrial protein, expressed in E. coli. ||Molecular Weight: |~16.5kD||AA Sequence:|NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.