Small Proline-rich Protein 2B, Recombinant, Human, aa1-72, His-tag, Myc-tag (SPRR2B)

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.||Source:|Recombinant protein corresponding to aa1-72 from Human Small Proline-rich Protein 2, fused to His-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in Yeast.||Molecular Weight: |~12.0kD||AA Sequence:|MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK||Storage and Stability: |May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.