SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein , CSR, CSR1, APC7, MSLR1, MSRL1) (PE)
Cat# 132993-PE-100ul
Size : 100ul
Brand : US Biological
132993-PE SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein , CSR, CSR1, APC7, MSLR1, MSRL1) (PE)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
Hu Mo RtAccession #
NM_016240, NP_057324Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeApplications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.||Note: Applications are based on unconjugated antibody.
Applications
Product Type: Mab|Isotype: IgG2a,k|Clone No: 3A2|Host: mouse|Source: human|Concentration: As reported |Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant corresponding to aa316-416 from human SCARA3 (NP_057324) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human SCARA3. Species Crossreactivity: mouse and rat.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa316-416 from human SCARA3 (NP_057324) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SCARA3. Species Crossreactivity: mouse and rat.