GCM1 (glial Cells missing Homolog 1 (Drosophila), GCMA, hGCMa)
Cat# 246525-100ug
Size : 100ug
Brand : US Biological
246525 GCM1 (glial Cells missing Homolog 1 (Drosophila), GCMA, hGCMa)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
PurifiedApplications
E WBCrossreactivity
HuAccession #
NP_003634Shipping Temp
Blue IceStorage Temp
-20°CThis gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. [provided by RefSeq||Applications: |Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilutions:|Optimal dilutions to be determined by the researcher.||Amino Acid Sequence:|NVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCGRDCLAEEGRKIYLRPAICDKARQKQQRKRCPNCDGPLK||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.