GATA6 antibody - middle region

Cat# ARP31859_P050

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790

GATA6 Antibody - middle region (ARP31859_P050)

Rating:
90% of 100
Datasheets/ManualsPrintable datasheet for anti-GATA6 (ARP31859_P050) antibody
Product Info
Publications

Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). 24707296

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, IHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GATA6
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 93%; Rat: 86%; Sheep: 93%
Peptide SequenceSynthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
Concentration0.5 mg/ml
Blocking PeptideFor anti-GATA6 (ARP31859_P050) antibody is Catalog # AAP31859 (Previous Catalog # AAPP02654)
Other Applications Image 1 DataImmunofluorescence: Human Embryonic Stem Cell Line
Dilution: 1:250
ReferenceGhatnekar,A. (2008) Biochim. Biophys. Acta 1779 (3), 145-151
Gene SymbolGATA6
Gene Full NameGATA binding protein 6
Alias SymbolsASD9, AVSD5, PACHD
NCBI Gene Id2627
Protein NameTranscription factor GATA-6
Description of TargetGATA6 is thought to be important for regulating terminal differentiation and/or proliferation.
Uniprot IDQ92908
Protein Accession #NP_005248
Nucleotide Accession #NM_005257
Protein Size (# AA)595
Molecular Weight60kDa
Protein InteractionsKPNA3; SP1; CDK9; HHEX; MED1; EP300; CRIP2; NKX2-1; KLF2;

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT