Recombinant protein corresponding to the Human wild type Transthyretin. GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELH GLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYS YSTTAVVTNPKE The epitope has been mapped to residue 56-61
Sub class:
IgG1
Host:
Mouse
Clonality:
Monoclonal
Purity:
Affinity purified in PBS pH 7.4.
Format:
Lyophilized
Quantity:
100 " data-field-id="Reconstitution">
Reconstitution:
Add 100 mg/ml
Storage:
Store lyophilized/reconstituted at 4" data-field-id="Tested applications">
Tested applications:
ELISA (ELISA), Immunohistochemistry (IHC), Western blot (WB)
Recommended dilution:
1:1000 (ELISA), 1:500 (IHC), 1:1000 (WB)
Expected | apparent MW:
155
Reactivity
Confirmed reactivity:
Human Transthyretin Amyloids
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Additional Information
Additional information (application):
Specifically reactive to the amyloid form of human Transthyretin. Epitope mapped to residue 56-61 which remains buried within the native fold of transthyretin but becomes exposed within its amyloid form. It has been suggested that that two distinct mechanisms of TTR-amyloidosis exists. The first, most common seen in wild type TTR Amyloidosis, consists of the full length TTR. Whereas the other type of amyloidosis mainly consists of the C-terminal region of the protein and is more common in mutant versions of TTR. Mouse IgG1 Anti-Transthyretin 56-61 (Amyloid Specific) epitope is located at the C-terminal strand of cleaved TTR and is suitable to detect amyloid formation derived from the C-terminal.
Background
Background:
Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. The wild type form of TTR is associated with a late onset amyloidosis denoted senile systemic amyloidosis, affecting around 10% of the population above 80 years of age with depositions mainly found in the heart.
Monoclonal IgG1 antibody. Amyloid specific for human Transthyretin. Detects the C-terminal fragment 49-127 frequently formed in vivo.
Product Citations
Selected references:
Goldsteins et al. (1999). Exposure of cryptic epitopes on transthyretin only in amyloid and in amyloidogenic mutants. Proc Natl Acad Sci U S A. 1999 Mar 16; 96(6): 3108–3113
AS15 TMB-HRP | TMB based, especially formulated with extreme sensitivity, HRP substrate for microwell application. - 10ml trial size is restricted to one unit per customer -
We use cookies to improve our website and to provide you with a better experience. By continuing to use the website, you agree to this. Read more.
Cookie Settings
We use cookies to personalize content and ads, to provide social media features, and to analyze our traffic. We also share information about your use of our site with our social media, advertising, and analytics partners who may combine it with other information that you've provided to them or that they've collected from your use of their services.
We respect your privacy, and that's why we give you control over which types of cookies we use on our site. You can choose to accept or decline certain types of cookies by clicking the settings button below.
Necessary Cookies
These cookies are necessary for the website to function and cannot be switched off in our systems. They are usually only set in response to actions made by you which amount to a request for services, such as setting your privacy preferences, logging in, or filling in forms. You can set your browser to block or alert you about these cookies, but some parts of the site will not then work. These cookies do not store any personally identifiable information.
Performance Cookies
These cookies allow us to count visits and traffic sources so we can measure and improve the performance of our site. They help us to know which pages are the most and least popular and see how visitors move around the site. All information these cookies collect is aggregated and therefore anonymous. If you do not allow these cookies we will not know when you have visited our site, and will not be able to monitor its performance.
Functional Cookies
These cookies enable the website to provide enhanced functionality and personalization. They may be set by us or by third party providers whose services we have added to our pages. If you do not allow these cookies then some or all of these services may not function properly.
Targeting Cookies
These cookies may be set through our site by our advertising partners. They may be used by those companies to build a profile of your interests and show you relevant adverts on other sites. They do not store directly personal information, but are based on uniquely identifying your browser and internet device. If you do not allow these cookies, you will experience less targeted advertising.
By clicking “Accept All Cookies”, you agree to the use of all of the above cookies. You can change your cookie settings at any time by clicking on “Cookie Settings” and selecting the categories that you want to enable or disable.
Phone : +1 850 650 7790
