K99 Fimbrial Protein, Recombinant, E. coli, aa23-181 (fanC)

Cat# 405969-100ug

Size : 100ug

Brand : US Biological

Contact local distributor :


Phone : +1 850 650 7790


405969 Rabbit Anti-K99 Fimbrial Protein, Recombinant, E. coli, aa23-181 (fanC)

Clone Type
Polyclonal
Swiss Prot
P18103
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. FanC is the main component of the K99 fimbriae.||Source:|Recombinant protein corresponding to aa23-181 from E. coli K99 fimbrial protein, expressed in E. coli. ||Molecular Weight: |~16.5kD||AA Sequence:|NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ~90% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
Purity
~90% (SDS-PAGE)
References
1. "The penultimate tyrosine residue of the K99 fibrillar subunit is essential for stability of the protein and its interaction with the periplasmic carrier protein." Simons B.L., Rathman P., Maij C.R., Oudega B., de Graaf F.K. FEMS Microbiol. Lett. 55:107-112(1990)