Insr antibody - middle region
Cat# ARP41373_P050
Size : 100ul
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-Insr (ARP41373_P050) antibody |
---|
Tested Species Reactivity | Human, Mouse |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100% |
Peptide Sequence | Synthetic peptide located within the following region: EEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPY |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-Insr (ARP41373_P050) antibody is Catalog # AAP41373 (Previous Catalog # AAPP24111) |
Gene Symbol | Insr |
---|---|
Gene Full Name | Insulin receptor |
Alias Symbols | I, IR, IR-A, IR-B, CD220, 4932439J01Rik, D630014A15Rik |
NCBI Gene Id | 16337 |
Protein Name | Insulin receptor |
Description of Target | This receptor binds insulin and has a tyrosine-protein kinase activity. When it is present in a hybrid receptor with IGF1R, binds IGF1. |
Uniprot ID | P15208 |
Protein Accession # | NP_034698 |
Nucleotide Accession # | NM_010568 |
Protein Size (# AA) | 1372 |
Molecular Weight | 155kDa |
Protein Interactions | Arrb2; Src; Akt1; Jup; Irs1; Grb10; Snx9; Dok3; Sh2b2; Flot1; Dok1; Cav3; Socs1; Socs3; Sorbs1; Cav1; Pik3r1; |