FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) (PE)
Cat# 126611-PE-100ul
Size : 100ul
Brand : US Biological
126611-PE FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) (PE)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
E IHC WBCrossreactivity
HuAccession #
BC026346; AAH26346Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeFAM84A (Family with sequence similarity 84 member A) was identified in a screen for genes up-regulated in colon cancer. It may play a role in cell migration and has a critical role in the progression of colon cancer.||Applications:|Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.||Recommended Dilution:|Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml|Optimal dilutions to be determined by the researcher.||AA Sequence:|MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQHAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.||Note: Applications are based on unconjugated antibody.