Acidic Protein MsyB, Recombinant, E. coli, aa1-124, His-tag (msyB)

Cat# 405859-20ug

Size : 20ug

Brand : US Biological

Contact local distributor :


Phone : +1 850 650 7790


405859 Rabbit Anti-Acidic Protein MsyB, Recombinant, E. coli, aa1-124, His-tag (msyB)

Clone Type
Polyclonal
Swiss Prot
P25738
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Could participate in the normal pathway of protein export.||Source:|Full-length recombinant protein corresponding to aa1-124 from E. coli Acidic Protein MsyB, fused to His-tag at C-terminal, expressed in Baculovirus.||Molecular Weight: |~16.3kD||Amino Acid Sequence:|MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER||Storage and Stability: |May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, Baculovirus|Purity: ~85% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 10% glycerol.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 10% glycerol.
Purity
~85% (SDS-PAGE)
References
1. Multicopy suppression: an approach to understanding intracellular functioning of the protein export system." Ueguchi C., Ito K. J. Bacteriol. 174:1454-1461 (1992).