ACAA2 (Acetyl-Coenzyme A Acyltransferase 2, DSAEC, FLJ35992, FLJ95265) (FITC)
Cat# 243009-FITC-100ul
Size : 100ul
Brand : US Biological
243009-FITC Rabbit Anti-ACAA2 (Acetyl-Coenzyme A Acyltransferase 2, DSAEC, FLJ35992, FLJ95265) (FITC)
Clone Type
PolyclonalHost
mouseIsotype
IgG1,kGrade
PurifiedApplications
E WBAccession #
NP_006102Shipping Temp
Blue IceStorage Temp
-20°CThe encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq||Applications: |Suitable for use in Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. |Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. ||Note: Applications are based on unconjugated antibody.