Sprr2a, Recombinant, Mouse, aa1-83, His-Tag (Small Proline-rich Protein 2A)
Référence 375396-100ug
Conditionnement : 100ug
Marque : US Biological
375396 Rabbit Anti-Sprr2a, Recombinant, Mouse, aa1-83, His-Tag (Small Proline-rich Protein 2A)
Clone Type
PolyclonalSwiss Prot
Q9CQK8Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CCross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.||Source:|Recombinant protein corresponding to aa1-83 from mouse Sprr2a, fused to His-Tag at N-terminal expressed in E. coli.||Molecular Weight: |~13.4kD||Amino Acid Sequence:|MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.