SCML4, Recombinant, Human, aa1-305, His-SUMO-Tag (Sex Comb on Midleg-like Protein 4)
Référence 375221-100ug
Conditionnement : 100ug
Marque : US Biological
375221 Rabbit Anti-SCML4, Recombinant, Human, aa1-305, His-SUMO-Tag (Sex Comb on Midleg-like Protein 4)
Clone Type
PolyclonalSwiss Prot
Q8N228Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CPutative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development.||Source:|Recombinant protein corresponding to aa1-305 from human SCML4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. ||Molecular Weight: |~49kD||Amino Acid Sequence:|MPCQRTAWIGCDRQRTPPFHWREIKSRVLMTPLALSPPRSTPEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERKKVQQLPEHFGPERPSAVLQQAVQACIDCAHQQKLVFSLVKQGYGGEMVSVSASFDGKQHLRSLPVVNSIGYVLRFLAKLCRSLLCDDLFSHQPFPRGCSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGDSHLGGGPAATAGGPRTSPMSSGGPSAPGLRPPASSPKRNTTSLEGNRCGNVMHASASH||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.