RVG-9R
ACF
ID | 68 |
key | field_611d2aa11d79c |
label | Sequence |
name | sequence_ |
prefix | acf |
type | text |
value | H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH |
menu_order | 1 |
required | 0 |
conditional_logic | 0 |
parent | 67 |
wrapper | Array ( [width] => [class] => [id] => ) |
_name | sequence_ |
_valid | 1 |
Module Settings
custom_identifier | ACF Item |
acf_name | field_611d2aa11d79c |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | off |
label_seperator | : |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | DM - Sequence |
_builder_version | 4.16 |
_module_preset | default |
title_css_text_color | #2d7abf |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {"gcid-f71e32a6-6d24-4beb-adc3-f38b1f4074ed":["title_css_text_color"]} |
H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH
Execution time: 0.0013 seconds
ACF
ID | 1523 |
key | field_612b94055efd3 |
label | SKU-Product-No |
name | sku-product-no |
prefix | acf |
type | text |
value | 4058134 |
menu_order | 3 |
required | 0 |
conditional_logic | 0 |
parent | 67 |
wrapper | Array ( [width] => [class] => [id] => ) |
_name | sku-product-no |
_valid | 1 |
Module Settings
custom_identifier | ACF Item |
acf_name | field_612b94055efd3 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | : |
custom_label | Product Number |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | DM - Product No. |
_builder_version | 4.16 |
_module_preset | default |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||5px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {} |
Product Number: 4058134
Execution time: 0.0010 seconds
ACF
ID | 69 |
key | field_611d2ada1d79d |
label | CAS Number |
name | cas_number |
prefix | acf |
type | text |
value | 1678417-57-6 |
menu_order | 2 |
required | 0 |
conditional_logic | 0 |
parent | 67 |
wrapper | Array ( [width] => [class] => [id] => ) |
_name | cas_number |
_valid | 1 |
Module Settings
custom_identifier | ACF Item |
acf_name | field_611d2ada1d79d |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | : |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | DM - Cas Number |
_builder_version | 4.16 |
_module_preset | default |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||5px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {} |
CAS Number: 1678417-57-6
Execution time: 0.0012 seconds
€ 294.26 – € 502.05
Pack size available | 0.5mg, 1mg |
---|
Execution time: 0.0005 seconds
Please select pack size:
Product Description
Chimeric rabies virus glycoprotein fragment peptide (RVG-9R peptide) was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. Repeated administration of RVG-9R-bound siRNA did not induce inflammatory cytokines nor anti-peptide antibodies.
ACF
ID | 438 |
key | field_6125071b6e694 |
label | ADS Lookup |
name | ads_lookup |
prefix | acf |
type | url |
value | https://ads-pub.bachem.com/QCRFADSPublisher/ADS/StreamADS?key0=4058134.0500&key1=1060345 |
menu_order | 1 |
required | 0 |
conditional_logic | 0 |
parent | 436 |
wrapper | Array ( [width] => [class] => [id] => ) |
placeholder | ADS Lookup Url. |
_name | ads_lookup |
_valid | 1 |
Module Settings
custom_identifier | Example ADS |
acf_name | field_6125071b6e694 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | |
custom_label | Example ADS |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
image | /proxy_img/aHR0cHM6Ly9zaG9wLmJhY2hlbS5jb20vd3AtY29udGVudC91cGxvYWRzLzIwMjEvMDkvSUNPTl9BRFMtQmx1ZV9SR0IucG5n |
alt | ADS |
icon_image_placement | top |
image_max_width | 30% |
image_mobile_stacking | column |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | on |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | on |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
button_alignment | center |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
_builder_version | 4.16 |
_module_preset | default |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_text_align | center |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
text_orientation | center |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||20px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {} |
Execution time: 0.0011 seconds
ACF
ID | 247951 |
key | field_61a0c2334b2b9 |
label | ADS Search CS |
name | ads_search |
prefix | acf |
type | url |
value | https://www.bachem.com/products/research-and-specialties/catalog-peptides/analytical-data-sheet-ads/ |
menu_order | 3 |
required | 0 |
conditional_logic | 0 |
parent | 436 |
wrapper | Array ( [width] => [class] => [id] => ) |
_name | ads_search |
_valid | 1 |
Module Settings
custom_identifier | ADS search |
acf_name | field_61a0c2334b2b9 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | |
custom_label | ADS Lookup |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
image | /proxy_img/aHR0cHM6Ly9zaG9wLmJhY2hlbS5jb20vd3AtY29udGVudC91cGxvYWRzLzIwMjEvMDkvSUNPTl9BRFMtQmx1ZV9SR0IucG5n |
alt | ADS lookup |
icon_image_placement | top |
image_max_width | 30% |
image_mobile_stacking | column |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | on |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | on |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
button_alignment | center |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | ADS - Search |
_builder_version | 4.16 |
_module_preset | default |
title_css_text_align | center |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_text_align | center |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
text_orientation | center |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||20px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {} |
Execution time: 0.0009 seconds
ACF
ID | 439 |
key | field_612507456e695 |
label | MSDS Lookup |
name | msds_lookup_ |
prefix | acf |
type | url |
value | https://msds.bachem.com/MSDSSearch/servlet/ext/StreamExtPDF?pdf=4058134 |
menu_order | 0 |
required | 0 |
conditional_logic | 0 |
parent | 436 |
wrapper | Array ( [width] => [class] => [id] => ) |
placeholder | MSDS Lookup Url. |
_name | msds_lookup_ |
_valid | 1 |
Module Settings
custom_identifier | MSDS |
acf_name | field_612507456e695 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | |
custom_label | MSDS |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
image | /proxy_img/aHR0cHM6Ly9zaG9wLmJhY2hlbS5jb20vd3AtY29udGVudC91cGxvYWRzLzIwMjEvMDkvSUNPTl9NU0RTLUJsdWVfUkdCLnBuZw== |
alt | MSDS |
icon_image_placement | top |
image_max_width | 30% |
image_mobile_stacking | column |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | on |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | on |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
button_alignment | center |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | MSDS - lookup |
_builder_version | 4.16 |
_module_preset | default |
title_css_text_align | center |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_text_align | center |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
text_orientation | center |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||20px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {} |
Execution time: 0.0011 seconds
ACF
ID | 247950 |
key | field_61a0c20f4b2b8 |
label | MSDS Search CS |
name | msds_search |
prefix | acf |
type | url |
value | https://www.bachem.com/products/research-and-specialties/catalog-peptides/msds-material-safety-data-sheet/ |
menu_order | 2 |
required | 0 |
conditional_logic | 0 |
parent | 436 |
wrapper | Array ( [width] => [class] => [id] => ) |
_name | msds_search |
_valid | 1 |
Module Settings
custom_identifier | MSDS search |
acf_name | field_61a0c20f4b2b8 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | |
custom_label | MSDS Lookup |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
image | /proxy_img/aHR0cHM6Ly9zaG9wLmJhY2hlbS5jb20vd3AtY29udGVudC91cGxvYWRzLzIwMjEvMDkvSUNPTl9NU0RTLUJsdWVfUkdCLnBuZw== |
alt | MSDS lookup |
icon_image_placement | top |
image_max_width | 30% |
image_mobile_stacking | column |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | on |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | on |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
button_alignment | center |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | MSDS - search |
_builder_version | 4.16 |
_module_preset | default |
title_css_text_align | center |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_text_align | center |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
text_orientation | center |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||20px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {} |
Execution time: 0.0014 seconds
ACF
ID | 232542 |
key | field_6177d326319a1 |
label | Brochure Link |
name | brochure_0_brochure_link |
prefix | acf |
type | url |
value | https://www.bachem.com/knowledge-center/white-papers/cell-permeable-peptides/ |
menu_order | 1 |
required | 0 |
conditional_logic | 0 |
parent | 232540 |
wrapper | Array ( [width] => [class] => [id] => ) |
_name | brochure_link |
_valid | 1 |
parent_repeater | field_6177d3262eee2 |
Module Settings
custom_identifier | ACF Item |
acf_name | field_6177d326319a1 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | h4 |
show_label | off |
label_seperator | : |
suffix | |
visibility | on |
empty_value_option | hide_parent_section |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | url |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | list |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | on |
link_name_acf_name | field_6177d32631968 |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | on |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | field_6177d32631968 |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
disabled_on | off|off|off |
admin_label | .ACF Item - Brochure link With Title |
_builder_version | 4.16 |
_module_preset | default |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_font | |700||||||| |
label_css_text_color | #004080 |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | |20px|||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
custom_css_main_element | display: inline-block; |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
locked | off |
global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["label_css_text_color"],"gcid-f71e32a6-6d24-4beb-adc3-f38b1f4074ed":["label_css_text_color__hover"]} |
label_css_text_color__hover_enabled | on|desktop |
label_css_text_color__hover | #2d7abf |
Execution time: 0.0011 seconds
ACF
ID | 265759 |
key | field_61e06583839c2 |
label | Link |
name | literature_0_lit_link |
prefix | acf |
type | url |
value | http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=24785241 |
menu_order | 1 |
required | 0 |
conditional_logic | 0 |
parent | 265757 |
wrapper | Array ( [width] => [class] => [id] => ) |
_name | lit_link |
_valid | 1 |
parent_repeater | field_61e064a3839bf |
Module Settings
custom_identifier | ACF Item |
acf_name | field_61e06583839c2 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | h4 |
show_label | off |
label_seperator | : |
suffix | |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | url |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | list |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | on |
link_name_acf_name | field_61e064f3839c0 |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | on |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | field_61e064f3839c0 |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
disabled_on | off|off|off |
admin_label | .ACF Item - Literature link With Title |
_builder_version | 4.16 |
_module_preset | default |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_font | |700||||||| |
label_css_text_color | #004080 |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | |20px|||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
custom_css_main_element | display: inline-block; |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
locked | off |
global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["label_css_text_color"],"gcid-f71e32a6-6d24-4beb-adc3-f38b1f4074ed":["label_css_text_color__hover"]} |
label_css_text_color__hover_enabled | on|desktop |
label_css_text_color__hover | #2d7abf |
Execution time: 0.0014 seconds
ACF
ID | 265760 |
key | field_61e06598839c3 |
label | Gesamt |
name | literature_0_lit_gesamt |
prefix | acf |
type | text |
value | X.Koh-Stenta et al., Biochem. J., 461, 323 (2014) |
menu_order | 2 |
required | 0 |
conditional_logic | 0 |
parent | 265757 |
wrapper | Array ( [width] => [class] => [id] => ) |
_name | lit_gesamt |
_valid | 1 |
parent_repeater | field_61e064a3839bf |
Module Settings
custom_identifier | ACF Item |
acf_name | field_61e06598839c3 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | off |
label_seperator | : |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | label |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | .ACF Item - Gesamt |
_builder_version | 4.16 |
_module_preset | default |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_margin | |10px|||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
custom_css_main_element | display: inline-block; |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {} |
X.Koh-Stenta et al., Biochem. J., 461, 323 (2014)
Execution time: 0.0010 seconds
ACF
ID | 265759 |
key | field_61e06583839c2 |
label | Link |
name | literature_1_lit_link |
prefix | acf |
type | url |
value | http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21423625 |
menu_order | 1 |
required | 0 |
conditional_logic | 0 |
parent | 265757 |
wrapper | Array ( [width] => [class] => [id] => ) |
_name | lit_link |
_valid | 1 |
parent_repeater | field_61e064a3839bf |
Module Settings
custom_identifier | ACF Item |
acf_name | field_61e06583839c2 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | h4 |
show_label | off |
label_seperator | : |
suffix | |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | url |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | list |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | on |
link_name_acf_name | field_61e064f3839c0 |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | on |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | field_61e064f3839c0 |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
disabled_on | off|off|off |
admin_label | .ACF Item - Literature link With Title |
_builder_version | 4.16 |
_module_preset | default |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_font | |700||||||| |
label_css_text_color | #004080 |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | |20px|||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
custom_css_main_element | display: inline-block; |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
locked | off |
global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["label_css_text_color"],"gcid-f71e32a6-6d24-4beb-adc3-f38b1f4074ed":["label_css_text_color__hover"]} |
label_css_text_color__hover_enabled | on|desktop |
label_css_text_color__hover | #2d7abf |
Execution time: 0.0011 seconds
ACF
ID | 265760 |
key | field_61e06598839c3 |
label | Gesamt |
name | literature_1_lit_gesamt |
prefix | acf |
type | text |
value | C.Ye et al., PLoS One, 6, e17889 (2011) |
menu_order | 2 |
required | 0 |
conditional_logic | 0 |
parent | 265757 |
wrapper | Array ( [width] => [class] => [id] => ) |
_name | lit_gesamt |
_valid | 1 |
parent_repeater | field_61e064a3839bf |
Module Settings
custom_identifier | ACF Item |
acf_name | field_61e06598839c3 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | off |
label_seperator | : |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | label |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | .ACF Item - Gesamt |
_builder_version | 4.16 |
_module_preset | default |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_margin | |10px|||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
custom_css_main_element | display: inline-block; |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {} |
C.Ye et al., PLoS One, 6, e17889 (2011)
Execution time: 0.0009 seconds
ACF
ID | 427 |
key | field_6125054f3b2a2 |
label | Salt form |
name | salt_form |
prefix | acf |
type | text |
value | Trifluoroacetate |
menu_order | 0 |
required | 0 |
conditional_logic | 0 |
parent | 426 |
wrapper | Array ( [width] => [class] => [id] => ) |
placeholder | Salt form |
_name | salt_form |
_valid | 1 |
Module Settings
custom_identifier | Salt Form |
acf_name | field_6125054f3b2a2 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | : |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | .ACF Item -Salt Form |
_builder_version | 4.16 |
_module_preset | default |
title_css_font | |||||||| |
title_css_text_color | #004080 |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_font | |||||||| |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||8px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color"]} |
Salt form: Trifluoroacetate
Execution time: 0.0016 seconds
ACF
ID | 428 |
key | field_6125059a3b2a3 |
label | Molecular weight |
name | molecular_weight |
prefix | acf |
type | range |
value | 4843.51 |
menu_order | 1 |
required | 0 |
conditional_logic | 0 |
parent | 426 |
wrapper | Array ( [width] => [class] => [id] => ) |
min | 0 |
max | 31629 |
step | .01 |
_name | molecular_weight |
_valid | 1 |
Module Settings
custom_identifier | Mole wg |
acf_name | field_6125059a3b2a3 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | : |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | .ACF Item -Mole weight |
_builder_version | 4.16 |
_module_preset | default |
title_css_font | |||||||| |
title_css_text_color | #004080 |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_font | |||||||| |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||8px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Molecular weight: 4843.51
Execution time: 0.0016 seconds
ACF
ID | 429 |
key | field_612505b63b2a4 |
label | Sum Formula |
name | sum_formula |
prefix | acf |
type | text |
value | C₂₀₁H₃₃₄N₈₂O₅₅S₂ |
menu_order | 2 |
required | 0 |
conditional_logic | 0 |
parent | 426 |
wrapper | Array ( [width] => [class] => enbold [id] => ) |
placeholder | Sum Formula |
_name | sum_formula |
_valid | 1 |
Module Settings
custom_identifier | Sum Formula |
acf_name | field_612505b63b2a4 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | : |
custom_label | Chemical Formula |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | .ACF Item -Sum Formula |
_builder_version | 4.16 |
_module_preset | default |
title_css_font | |||||||| |
title_css_text_color | #004080 |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_font | |||||||| |
label_css_letter_spacing | 0px |
text_before_css_font | |||||||| |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font | |||||||| |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||8px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Chemical Formula: C₂₀₁H₃₃₄N₈₂O₅₅S₂
Execution time: 0.0017 seconds
ACF
ID | 430 |
key | field_612505e03b2a5 |
label | Storage Temperature |
name | storage_temperature |
prefix | acf |
type | text |
value | < -15°C |
menu_order | 3 |
required | 0 |
conditional_logic | 0 |
parent | 426 |
wrapper | Array ( [width] => [class] => [id] => ) |
placeholder | Storage Temperature |
_name | storage_temperature |
_valid | 1 |
Module Settings
custom_identifier | Storage Temp |
acf_name | field_612505e03b2a5 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | : |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | .ACF Item -Storage Temp |
_builder_version | 4.16 |
_module_preset | default |
title_css_font | |||||||| |
title_css_text_color | #004080 |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_font | |||||||| |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||8px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Storage Temperature: < -15°C
Execution time: 0.0012 seconds
ACF
ID | 432 |
key | field_612505fb1608e |
label | Synonyms |
name | synonym |
prefix | acf |
type | text |
value | Rabies Virus Glycoprotein (194-221) Nonaarginine Chimer |
menu_order | 4 |
required | 0 |
conditional_logic | 0 |
parent | 426 |
wrapper | Array ( [width] => [class] => [id] => ) |
placeholder | Synonym |
_name | synonym |
_valid | 1 |
Module Settings
custom_identifier | Synonym |
acf_name | field_612505fb1608e |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | : |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | .ACF Item - Synonym |
_builder_version | 4.16 |
_module_preset | default |
title_css_font | |||||||| |
title_css_text_color | #004080 |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_font | |||||||| |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||8px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Synonyms: Rabies Virus Glycoprotein (194-221) Nonaarginine Chimer
Execution time: 0.0010 seconds
ACF
ID | 435 |
key | field_6125064316091 |
label | One Letter code |
name | one_letter_code |
prefix | acf |
type | text |
value | YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR |
menu_order | 7 |
required | 0 |
conditional_logic | 0 |
parent | 426 |
wrapper | Array ( [width] => [class] => [id] => ) |
placeholder | One Letter code |
_name | one_letter_code |
_valid | 1 |
Module Settings
custom_identifier | One Letter code |
acf_name | field_6125064316091 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | : |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | .ACF Item - One Letter code |
_builder_version | 4.16 |
_module_preset | default |
title_css_font | |||||||| |
title_css_text_color | #004080 |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_font | |||||||| |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||8px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
One Letter code: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Execution time: 0.0011 seconds
ACF
ID | 433 |
key | field_612506121608f |
label | Source |
name | source |
prefix | acf |
type | text |
value | Synthetic |
menu_order | 5 |
required | 0 |
conditional_logic | 0 |
parent | 426 |
wrapper | Array ( [width] => [class] => [id] => ) |
placeholder | Source |
_name | source |
_valid | 1 |
Module Settings
custom_identifier | Source |
acf_name | field_612506121608f |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | : |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | .ACF Item - Source |
_builder_version | 4.16 |
_module_preset | default |
title_css_font | |||||||| |
title_css_text_color | #004080 |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_font | |||||||| |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||8px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Source: Synthetic
Execution time: 0.0012 seconds
ACF
ID | 434 |
key | field_6125062f16090 |
label | Old Product Number |
name | old_product_number |
prefix | acf |
type | text |
value | H-7502 |
menu_order | 6 |
required | 0 |
conditional_logic | 0 |
parent | 426 |
wrapper | Array ( [width] => [class] => [id] => ) |
placeholder | Old Product Number |
_name | old_product_number |
_valid | 1 |
Module Settings
custom_identifier | Catalog Number |
acf_name | field_6125062f16090 |
is_author_acf_field | off |
post_object_acf_name | none |
author_field_type | author_post |
linked_user_acf_name | none |
type_taxonomy_acf_name | none |
acf_tag | p |
show_label | on |
label_seperator | : |
visibility | on |
empty_value_option | hide_module |
element_in_section | off |
use_icon | off |
icon_color | #2d7abf |
use_circle | off |
circle_color | #2d7abf |
use_circle_border | off |
circle_border_color | #2d7abf |
use_icon_font_size | off |
icon_image_placement | left |
image_mobile_stacking | initial |
return_format | array |
auto_detect_video_audio | on |
image_link_url | off |
image_link_url_acf_name | none |
checkbox_style | array |
checkbox_radio_return | label |
checkbox_radio_value_type | off |
checkbox_radio_link | off |
link_button | off |
email_subject | none |
email_body_after | none |
add_css_class | off |
add_css_loop_layout | off |
add_css_class_selector | body |
link_new_tab | on |
link_name_acf | off |
link_name_acf_name | none |
url_link_icon | off |
url_as_image | off |
image_size | full |
image_full_width | off |
true_false_condition | off |
true_false_condition_css_selector | .et_pb_button |
true_false_text_true | True |
true_false_text_false | False |
is_audio | off |
is_video | off |
video_keep_aspect_ratio | on |
video_loop | on |
video_autoplay | on |
make_video_background | off |
video_background_size | cover |
is_oembed_video | off |
defer_video | off |
defer_video_icon | I||divi||400 |
video_icon_font_size | off |
pretify_text | off |
pretify_seperator | , |
number_decimal | . |
show_value_if_zero | off |
text_image | off |
is_options_page | off |
is_repeater_loop_layout | off |
linked_post_style | custom |
link_post_seperator | , |
link_to_post_object | on |
link_to_post_object_new_tab | off |
loop_layout | none |
columns | 4 |
columns_tablet | 2 |
columns_mobile | 1 |
user_field_return | display_name |
link_to_author_page | off |
repeater_dyn_btn_acf | none |
text_before_position | same_line |
label_position | same_line |
vertical_alignment | middle |
admin_label | .ACF Item - Old Product Number |
_builder_version | 4.16 |
_module_preset | default |
title_css_font | |||||||| |
title_css_text_color | #004080 |
title_css_font_size | 14px |
title_css_letter_spacing | 0px |
title_css_line_height | 1em |
acf_label_css_font_size | 14px |
acf_label_css_letter_spacing | 0px |
acf_label_css_line_height | 1em |
label_css_font | |||||||| |
label_css_letter_spacing | 0px |
text_before_css_font_size | 14px |
text_before_css_letter_spacing | 0px |
text_before_css_line_height | 1em |
seperator_font_size | 14px |
seperator_letter_spacing | 0px |
seperator_line_height | 1em |
relational_field_item_font_size | 14px |
relational_field_item_letter_spacing | 0px |
relational_field_item_line_height | 1em |
background_enable_color | on |
use_background_color_gradient | off |
background_color_gradient_repeat | off |
background_color_gradient_type | linear |
background_color_gradient_direction | 180deg |
background_color_gradient_direction_radial | center |
background_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
background_color_gradient_unit | % |
background_color_gradient_overlays_image | off |
background_color_gradient_start | #2b87da |
background_color_gradient_start_position | 0% |
background_color_gradient_end | #29c4a9 |
background_color_gradient_end_position | 100% |
background_enable_image | on |
parallax | off |
parallax_method | on |
background_size | cover |
background_image_width | auto |
background_image_height | auto |
background_position | center |
background_horizontal_offset | 0 |
background_vertical_offset | 0 |
background_repeat | no-repeat |
background_blend | normal |
background_enable_video_mp4 | on |
background_enable_video_webm | on |
allow_player_pause | off |
background_video_pause_outside_viewport | on |
background_enable_pattern_style | off |
background_pattern_style | polka-dots |
background_pattern_color | rgba(0,0,0,0.2) |
background_pattern_size | initial |
background_pattern_width | auto |
background_pattern_height | auto |
background_pattern_repeat_origin | top_left |
background_pattern_horizontal_offset | 0 |
background_pattern_vertical_offset | 0 |
background_pattern_repeat | repeat |
background_pattern_blend_mode | normal |
background_enable_mask_style | off |
background_mask_style | layer-blob |
background_mask_color | #ffffff |
background_mask_aspect_ratio | landscape |
background_mask_size | stretch |
background_mask_width | auto |
background_mask_height | auto |
background_mask_position | center |
background_mask_horizontal_offset | 0 |
background_mask_vertical_offset | 0 |
background_mask_blend_mode | normal |
custom_button | off |
button_text_size | 14 |
button_bg_use_color_gradient | off |
button_bg_color_gradient_repeat | off |
button_bg_color_gradient_type | linear |
button_bg_color_gradient_direction | 180deg |
button_bg_color_gradient_direction_radial | center |
button_bg_color_gradient_stops | #2b87da 0%|#29c4a9 100% |
button_bg_color_gradient_unit | % |
button_bg_color_gradient_overlays_image | off |
button_bg_color_gradient_start | #2b87da |
button_bg_color_gradient_start_position | 0% |
button_bg_color_gradient_end | #29c4a9 |
button_bg_color_gradient_end_position | 100% |
button_bg_enable_image | on |
button_bg_parallax | off |
button_bg_parallax_method | on |
button_bg_size | cover |
button_bg_image_width | auto |
button_bg_image_height | auto |
button_bg_position | center |
button_bg_horizontal_offset | 0 |
button_bg_vertical_offset | 0 |
button_bg_repeat | no-repeat |
button_bg_blend | normal |
button_bg_enable_video_mp4 | on |
button_bg_enable_video_webm | on |
button_bg_allow_player_pause | off |
button_bg_video_pause_outside_viewport | on |
button_use_icon | on |
button_icon_placement | right |
button_on_hover | on |
positioning | none |
position_origin_a | top_left |
position_origin_f | top_left |
position_origin_r | top_left |
width | auto |
max_width | none |
min_height | auto |
height | auto |
max_height | none |
custom_padding | ||8px||false|false |
filter_hue_rotate | 0deg |
filter_saturate | 100% |
filter_brightness | 100% |
filter_contrast | 100% |
filter_invert | 0% |
filter_sepia | 0% |
filter_opacity | 100% |
filter_blur | 0px |
mix_blend_mode | normal |
animation_style | none |
animation_direction | center |
animation_duration | 1000ms |
animation_delay | 0ms |
animation_intensity_slide | 50% |
animation_intensity_zoom | 50% |
animation_intensity_flip | 50% |
animation_intensity_fold | 50% |
animation_intensity_roll | 50% |
animation_starting_opacity | 0% |
animation_speed_curve | ease-in-out |
animation_repeat | once |
hover_transition_duration | 300ms |
hover_transition_delay | 0ms |
hover_transition_speed_curve | ease |
link_option_url_new_window | off |
sticky_position | none |
sticky_offset_top | 0px |
sticky_offset_bottom | 0px |
sticky_limit_top | none |
sticky_limit_bottom | none |
sticky_offset_surrounding | on |
sticky_transition | on |
motion_trigger_start | middle |
hover_enabled | 0 |
title_css_text_shadow_style | none |
title_css_text_shadow_horizontal_length | 0em |
title_css_text_shadow_vertical_length | 0em |
title_css_text_shadow_blur_strength | 0em |
title_css_text_shadow_color | rgba(0,0,0,0.4) |
acf_label_css_text_shadow_style | none |
acf_label_css_text_shadow_horizontal_length | 0em |
acf_label_css_text_shadow_vertical_length | 0em |
acf_label_css_text_shadow_blur_strength | 0em |
acf_label_css_text_shadow_color | rgba(0,0,0,0.4) |
label_css_text_shadow_style | none |
label_css_text_shadow_horizontal_length | 0em |
label_css_text_shadow_vertical_length | 0em |
label_css_text_shadow_blur_strength | 0em |
label_css_text_shadow_color | rgba(0,0,0,0.4) |
text_before_css_text_shadow_style | none |
text_before_css_text_shadow_horizontal_length | 0em |
text_before_css_text_shadow_vertical_length | 0em |
text_before_css_text_shadow_blur_strength | 0em |
text_before_css_text_shadow_color | rgba(0,0,0,0.4) |
seperator_text_shadow_style | none |
seperator_text_shadow_horizontal_length | 0em |
seperator_text_shadow_vertical_length | 0em |
seperator_text_shadow_blur_strength | 0em |
seperator_text_shadow_color | rgba(0,0,0,0.4) |
relational_field_item_text_shadow_style | none |
relational_field_item_text_shadow_horizontal_length | 0em |
relational_field_item_text_shadow_vertical_length | 0em |
relational_field_item_text_shadow_blur_strength | 0em |
relational_field_item_text_shadow_color | rgba(0,0,0,0.4) |
button_text_shadow_style | none |
button_text_shadow_horizontal_length | 0em |
button_text_shadow_vertical_length | 0em |
button_text_shadow_blur_strength | 0em |
button_text_shadow_color | rgba(0,0,0,0.4) |
box_shadow_style | none |
box_shadow_color | rgba(0,0,0,0.3) |
box_shadow_position | outer |
box_shadow_style_button | none |
box_shadow_color_button | rgba(0,0,0,0.3) |
box_shadow_position_button | outer |
text_shadow_style | none |
text_shadow_horizontal_length | 0em |
text_shadow_vertical_length | 0em |
text_shadow_blur_strength | 0em |
text_shadow_color | rgba(0,0,0,0.4) |
disabled | off |
global_colors_info | {"gcid-26ed69e5-024e-4d79-af60-a0cd8f862966":["title_css_text_color","title_css_text_color","title_css_text_color"]} |
Old Product Number: H-7502
Execution time: 0.0014 seconds
Country
Inquiry List
No products in the list