Recombinant SARS-CoV-2, RBD Protein (Alpha, B1.1.7, UK Variant)
Référence S351-500
Conditionnement : 500µg
Marque : Leinco Technologies
Recombinant SARSCoV2, RBD Protein (Alpha, B1.1.7, UK Variant)
Recombinant SARSCoV2, RBD Protein (Alpha, B1.1.7, UK Variant)
Product No.: S351
Alternate Names 20I/501Y.V1, VOC 202012/01, B.1.1.7, UK Variant, Spike Protein, SARSCoV2 Spike Protein, S1 Protein, S1 Subunit, S Protein, Receptor Binding Domain, RBD Product Type Recombinant Protein Expression Host HEK293 Cells Species SARSCoV2 ⋅ Virus Applications ELISA |
BackgroundThis alpha variant of SARSCoV2 (also known as 20I/501Y.V1, VOC 202012/01, or B.1.1.7) emerged in the United Kingdom (UK) with a large number of mutations. This variant has been detected in numerous countries, including the United States.1 The RBD mutation is N501Y, A570D. Severe acute respiratory syndrome coronavirus 2 (SARSCoV2), the causative agent of coronavirus disease 2019 (COVID19), is an enveloped, singlestranded, positivesense RNA virus that belongs to the Coronaviridae family 2. The SARSCoV2 genome, which shares 79.6% identity with SARSCoV, encodes four essential structural proteins: the spike (S), envelope (E), membrane (M), and nucleocapsid protein (N) 3. The S protein is a transmembrane, homotrimeric, class I fusion glycoprotein that mediates viral attachment, fusion, and entry into host cells 4. Each ~180 kDa monomer contains two functional subunits, S1 (~700 a.a) and S2 (~600 a.a), that mediate viral attachment and membrane fusion, respectively. S1 contains two major domains, the Nterminal (NTD) and Cterminal domains (CTD). The CTD contains the receptorbinding domain (RBD), which binds to the angiotensinconverting enzyme 2 (ACE2) receptor on host cells 46. Although both SARSCoV and SARSCoV2 bind the ACE2 receptor, the RBDs only share ~73% amino acid identity, and the SARSCoV2 RBD binds with a higher affinity compared to SARSCoV 4,7. The RBD is dynamic and undergoes hingelike conformational changes, referred to as the “down” or “up” conformations, which hide or expose the receptorbinding motifs, respectively 8. Following receptor binding, S1 destabilizes, and TMPRSS2 cleaves S2, which undergoes a pre to postfusion conformation transition, allowing for membrane fusion 9,10. Protein DetailsFormat Purified No Carrier Protein Purity >95% by SDS Page Product Concentration 0.5 mg/ml Endotoxin Level <0.10 EU per 1 μg of the protein by the LAL method Protein Accession No. Amino Acid Sequence RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIDDTTDAVRDPQTLEILDITPCS State of Matter Sterile Liquid Predicted Molecular Mass The predicted molecular mass is ~33 kDa. Predicted Molecular Mass ~33 kDa Formulation This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added. Due to inherent biochemical properties of proteins, certain products may be prone to precipitation over time. Precipitation may be removed by aseptic centrifugation and/or filtration. Storage and Stability This recombinant protein may be stored as received at 28°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at 80°C. Avoid Repeated Freeze Thaw Cycles. Country of Origin USA Shipping Next Day Ice Pack NCBI Gene Bank Applications and Recommended Usage ? (Quality Tested by Leinco) ELISA References & Citations1. Center for Disease Control and Prevention. 2020 2. Zhou, P., Yang, X., Wang, X. et al. Nature 579, 270–273. 2020. 3. Wu, F., Zhao, S., Yu, B. et al. Nature 579, 265–269. 2020. 4. Wrapp D, Wang N, Corbett KS, et al. bioRxiv. 2020.02.11.944462. 2020. 5. Walls AC, Park YJ, Tortorici MA, Wall A, McGuire AT, Veesler D. Cell. 181(2):281292.e6. 2020. 6. Li W, Zhang C, Sui J, et al. EMBO J. 24(8):16341643. 2005. 7. Shang, J., Ye, G., Shi, K. et al. Nature 581, 221–224. 2020. 8. Gui M, Song W, Zhou H, et al. Cell Res. 27(1):119129. 2017. 9. Walls AC, Tortorici MA, Snijder J, et al. Proc Natl Acad Sci U S A. 114(42):1115711162. 2017. 10.. Hoffmann M, KleineWeber H, Schroeder S, et al. Cell. 181(2):271280.e8. 2020. |