GATA6 antibody - middle region
Référence ARP31859_P050
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
GATA6 Antibody - middle region (ARP31859_P050)
| Datasheets/Manuals | Printable datasheet for anti-GATA6 (ARP31859_P050) antibody |
|---|
| Publications | Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). 24707296 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IF, IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GATA6 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 93%; Rat: 86%; Sheep: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-GATA6 (ARP31859_P050) antibody is Catalog # AAP31859 (Previous Catalog # AAPP02654) |
| Other Applications Image 1 Data | Immunofluorescence: Human Embryonic Stem Cell Line Dilution: 1:250 |
| Reference | Ghatnekar,A. (2008) Biochim. Biophys. Acta 1779 (3), 145-151 |
|---|---|
| Gene Symbol | GATA6 |
| Gene Full Name | GATA binding protein 6 |
| Alias Symbols | ASD9, AVSD5, PACHD |
| NCBI Gene Id | 2627 |
| Protein Name | Transcription factor GATA-6 |
| Description of Target | GATA6 is thought to be important for regulating terminal differentiation and/or proliferation. |
| Uniprot ID | Q92908 |
| Protein Accession # | NP_005248 |
| Nucleotide Accession # | NM_005257 |
| Protein Size (# AA) | 595 |
| Molecular Weight | 60kDa |
| Protein Interactions | KPNA3; SP1; CDK9; HHEX; MED1; EP300; CRIP2; NKX2-1; KLF2; |
