GATA6 antibody - middle region
Référence ARP31859_P050
Conditionnement : 100ul
Marque : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-GATA6 (ARP31859_P050) antibody |
---|
Publications | Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). 247072961$s> |
---|---|
Tested Species Reactivity | Human |
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Sheep |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IF, IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GATA6 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 86%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 93%; Rat: 86%; Sheep: 93% |
Peptide Sequence | Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-GATA6 (ARP31859_P050) antibody is Catalog # AAP31859 (Previous Catalog # AAPP02654) |
Other Applications Image 1 Data | Immunofluorescence: Human Embryonic Stem Cell Line Dilution: 1:250 |
Reference | Ghatnekar,A. (2008) Biochim. Biophys. Acta 1779 (3), 145-151 |
---|---|
Gene Symbol | GATA6 |
Gene Full Name | GATA binding protein 6 |
Alias Symbols | ASD9, AVSD5, PACHD |
NCBI Gene Id | 2627 |
Protein Name | Transcription factor GATA-6 |
Description of Target | GATA6 is thought to be important for regulating terminal differentiation and/or proliferation. |
Uniprot ID | Q92908 |
Protein Accession # | NP_005248 |
Nucleotide Accession # | NM_005257 |
Protein Size (# AA) | 595 |
Molecular Weight | 60kDa |
Protein Interactions | KPNA3; SP1; CDK9; HHEX; MED1; EP300; CRIP2; NKX2-1; KLF2; |