FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517)
Référence 126611-100ug
Conditionnement : 100ug
Marque : US Biological
126611 FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
E IHC WBCrossreactivity
HuAccession #
BC026346; AAH26346Shipping Temp
Blue IceStorage Temp
-20°CFAM84A (Family with sequence similarity 84 member A) was identified in a screen for genes up-regulated in colon cancer. It may play a role in cell migration and has a critical role in the progression of colon cancer.||Applications:|Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.||Recommended Dilution:|Immunohistochemistry (FFPE): 5ug/ml|Optimal dilutions to be determined by the researcher.||AA Sequence:|MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQHAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.